Copine-6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179763

Catalog No. NBP179763

Description

Copine-6 Polyclonal specifically detects Copine-6 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: Copine-6
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Copine VI, copine VI (neuronal), copine-6, N-COPINE, neuronal copine, Neuronal-copine
• Host Species: Rabbit
• Molecular Weight of Antigen: 62 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_034077
• Gene Symbols: CPNE6
• Immunogen: The specific Immunogen is proprietary information. Peptide sequence YLQALRTVGGICQDYDSDKRFPAFGFGARIPPNFEVSHDFAINFDPENPE.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9362
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.