Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Copine-6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | Copine-6 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
Copine-6 Polyclonal specifically detects Copine-6 in Mouse samples. It is validated for Western Blot.Specifications
Copine-6 | |
Polyclonal | |
Rabbit | |
NP_034077 | |
9362 | |
The specific Immunogen is proprietary information. Peptide sequence YLQALRTVGGICQDYDSDKRFPAFGFGARIPPNFEVSHDFAINFDPENPE. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
Copine VI, copine VI (neuronal), copine-6, N-COPINE, neuronal copine, Neuronal-copine | |
CPNE6 | |
IgG | |
62 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title