Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Copine-6 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | Copine-6 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP179763
|
Novus Biologicals
NBP179763 |
100 μL |
Each of 1 for $436.00
|
|
Description
Copine-6 Polyclonal specifically detects Copine-6 in Mouse samples. It is validated for Western Blot.Specifications
Copine-6 | |
Polyclonal | |
Rabbit | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
Copine VI, copine VI (neuronal), copine-6, N-COPINE, neuronal copine, Neuronal-copine | |
CPNE6 | |
IgG | |
Affinity Purified | |
62 kDa |
Western Blot | |
Unconjugated | |
RUO | |
NP_034077 | |
9362 | |
The specific Immunogen is proprietary information. Peptide sequence YLQALRTVGGICQDYDSDKRFPAFGFGARIPPNFEVSHDFAINFDPENPE. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title