COPS4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156646

Catalog No. NBP156646

Description

COPS4 Polyclonal specifically detects COPS4 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: COPS4
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: COP9 constitutive photomorphogenic homolog subunit 4 (Arabidopsis), COP9 signalosome complex subunit 4, CSN4Arabidopsis, homolog) subunit 4, MANOP1, MGC10899, MGC15160
• Host Species: Rabbit
• Molecular Weight of Antigen: 46 kDa
• Quantity: 100 μL
• Research Discipline: DNA Repair, Neuronal Cell Markers, Neurotransmission
• Gene ID (Entrez): 51138
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9BT78
• Gene Symbols: COPS4
• Immunogen: Synthetic peptide directed towards the middle region of human COPS4 (NP_057213). Peptide sequence YKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHYKVCYA The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: 4.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG