Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
COPS4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15664620UL
Description
COPS4 Polyclonal specifically detects COPS4 in Human samples. It is validated for Western Blot.Specifications
COPS4 | |
Polyclonal | |
Western Blot 0.2-1 ug/ml | |
Q9BT78 | |
COPS4 | |
Synthetic peptide directed towards the middle region of human COPS4 (NP_057213). Peptide sequence YKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHY | |
Affinity Purified | |
RUO | |
Primary | |
This product is specific to Subunit or Isoform: 4. | |
Store at -20C. Avoid freeze-thaw cycles. |
Western Blot | |
Unconjugated | |
PBS and 2% Sucrose with 0.09% Sodium Azide | |
COP9 constitutive photomorphogenic homolog subunit 4 (Arabidopsis), COP9 signalosome complex subunit 4, CSN4Arabidopsis, homolog) subunit 4, MANOP1, MGC10899, MGC15160 | |
Rabbit | |
46 kDa | |
20 μL | |
DNA Repair, Neuronal Cell Markers, Neurotransmission | |
51138 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction