Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

COPS4 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15664620 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15664620 20 μL
NBP156646 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15664620 Supplier Novus Biologicals Supplier No. NBP15664620UL

Rabbit Polyclonal Antibody

COPS4 Polyclonal specifically detects COPS4 in Human samples. It is validated for Western Blot.

Specifications

Antigen COPS4
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.2-1 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9BT78
Gene Alias COP9 constitutive photomorphogenic homolog subunit 4 (Arabidopsis), COP9 signalosome complex subunit 4, CSN4Arabidopsis, homolog) subunit 4, MANOP1, MGC10899, MGC15160
Gene Symbols COPS4
Host Species Rabbit
Immunogen Synthetic peptide directed towards the middle region of human COPS4 (NP_057213). Peptide sequence YKLETYLKIARLYLEDDDPVQAEAYINRASLLQNESTNEQLQIHY
Molecular Weight of Antigen 46 kDa
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Research Discipline DNA Repair, Neuronal Cell Markers, Neurotransmission
Primary or Secondary Primary
Gene ID (Entrez) 51138
Test Specificity This product is specific to Subunit or Isoform: 4.
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.