Corin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159663

Catalog No. NBP159663

Description

Corin Polyclonal specifically detects Corin in Human samples. It is validated for Western Blot.

Specifications

• Antigen: Corin
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: CORIN
• Immunogen: Synthetic peptides corresponding to CORIN(corin, serine peptidase) The peptide sequence was selected from the C terminal of CORIN. Peptide sequence HPRYSRAVVDYDISIVELSEDISETGYVRPVCLPNPEQWLEPDTYCYITG.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10699
• Target Species: Human, Mouse, Rat, Pig, Bovine, Equine, Guinea Pig, Rabbit
• Form: Purified

• Applications: Western Blot
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: atrial natriuteric peptide-converting enzyme, Corin, corin, serine peptidase, EC 3.4.21, EC 3.4.21.-, heart specific serine proteinase, Heart-specific serine proteinase ATC2, MGC119742, pro-ANP-convertase, Pro-ANP-converting enzyme, PRSC, serine protease, Transmembrane protease serine 10
• Host Species: Rabbit
• Molecular Weight of Antigen: 74 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

For Research Use Only