Cortistatin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169148

Catalog No. NBP169148

Description

Cortistatin Polyclonal specifically detects Cortistatin in Human, Rat samples. It is validated for Western Blot, ELISA.

Specifications

• Antigen: Cortistatin
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Symbols: CORT
• Immunogen: Synthetic peptides corresponding to CORT (cortistatin) The peptide sequence was selected from the N terminal of CORT. Peptide sequence MPLSPGLLLLLLSGATATAALPLEGGPTGRDSEHMQEAAGIRKSSLLTFL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, ELISA
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, ELISA
• Gene Alias: cortistatin, cortistatin-14, cortistatin-17, cortistatin-29, CST-14, CST-17, CST-29, MGC32686, preprocortistatin
• Host Species: Rabbit
• Molecular Weight of Antigen: 2 kDa
• Quantity: 100 μL
• Research Discipline: Cytokine Research
• Gene ID (Entrez): 1325
• Target Species: Human, Rat
• Isotype: IgG