Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Cortistatin Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Antigen | Cortistatin |
---|---|
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Regulatory Status | RUO |
Description
Cortistatin Polyclonal specifically detects Cortistatin in Human, Rat samples. It is validated for Western Blot, ELISA.Specifications
Cortistatin | |
Unconjugated | |
RUO | |
cortistatin, cortistatin-14, cortistatin-17, cortistatin-29, CST-14, CST-17, CST-29, MGC32686, preprocortistatin | |
CORT | |
IgG | |
2 kDa |
Polyclonal | |
Rabbit | |
Cytokine Research | |
1325 | |
Synthetic peptides corresponding to CORT (cortistatin) The peptide sequence was selected from the N terminal of CORT. Peptide sequence MPLSPGLLLLLLSGATATAALPLEGGPTGRDSEHMQEAAGIRKSSLLTFL. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title