Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP16219520

COX18 Rabbit anti-Human, Polyclonal, Novus Biologicals™
SDP

Catalog No. NBP16219520 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP16219520 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP16219520 Supplier Novus Biologicals Supplier No. NBP16219520UL

Description

Rabbit Polyclonal Antibody

DPY19L2 Polyclonal specifically detects DPY19L2 in Human samples. It is validated for Western Blot.

Specifications

Antigen DPY19L2
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q6NUT2
Gene Alias dpy-19-like 2 (C. elegans), Dpy-19-like protein 2, FLJ32949, FLJ36166, protein dpy-19 homolog 2
Gene Symbols DPY19L2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to DPY19L2(dpy-19-like 2 (C. elegans)) The peptide sequence was selected form the middle region of DPY19L2. Peptide sequence IIGEFNNLPQEELLQWIKYSTTSDAVFAGAMPTMASIKLSTLHPIVNHPH.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 283417
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.