COX7B Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157028

Catalog No. NBP157028

Description

COX7B Polyclonal specifically detects COX7B in Human samples. It is validated for Western Blot.

Specifications

• Antigen: COX7B
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Cytochrome c oxidase polypeptide VIIb, cytochrome c oxidase subunit 7B, mitochondrial, cytochrome c oxidase subunit VIIb, cytochrome-c oxidase chain VIIb
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 1349
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P24311
• Gene Symbols: COX7B
• Immunogen: Synthetic peptides corresponding to COX7B (cytochrome c oxidase subunit VIIb) The peptide sequence was selected from the N terminal of COX7B. Peptide sequence MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCI.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: 7B, mitochondrial.
• Target Species: Human, Mouse, Rat, Pig, Rabbit
• Isotype: IgG