Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. COX7B Antibody, Novus Biologicals™

COX7B Antibody, Novus Biologicals™
SDP

Catalog No. NBP15702820 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15702820 20 μL
NBP157028 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15702820 Supplier Novus Biologicals Supplier No. NBP15702820UL

Description

Rabbit Polyclonal Antibody

COX7B Polyclonal specifically detects COX7B in Human samples. It is validated for Western Blot.

Specifications

Antigen COX7B
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P24311
Gene Alias Cytochrome c oxidase polypeptide VIIb, cytochrome c oxidase subunit 7B, mitochondrial, cytochrome c oxidase subunit VIIb, cytochrome-c oxidase chain VIIb
Gene Symbols COX7B
Host Species Rabbit
Immunogen Synthetic peptides corresponding to COX7B (cytochrome c oxidase subunit VIIb) The peptide sequence was selected from the N terminal of COX7B. Peptide sequence MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCI.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1349
Test Specificity This product is specific to Subunit or Isoform: 7B, mitochondrial.
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.