Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CPEB2 Antibody, Novus Biologicals™
SDP

Catalog No. NBP157416 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP157416 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP157416 Supplier Novus Biologicals Supplier No. NBP157416
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

CPEB2 Polyclonal specifically detects CPEB2 in Human samples. It is validated for Western Blot, Simple Western.

Specifications

Antigen CPEB2
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Simple Western 1:50
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q7Z5Q1-2
Gene Alias CPEB-2, CPE-binding protein 2, CPE-BP2, cytoplasmic polyadenylation element binding protein 2, cytoplasmic polyadenylation element-binding protein 2, hCPEB-2, MGC119575, MGC119576, MGC119577
Gene Symbols CPEB2
Host Species Rabbit
Immunogen Synthetic peptides corresponding to CPEB2 (cytoplasmic polyadenylation element binding protein 2) The peptide sequence was selected from the N terminal of CPEB2. Peptide sequence FLQQRNSYNHHQPLLKQSPWSNHQSSGWGTGSMSWGAMHGRDHRRTGNMG.
Molecular Weight of Antigen 65 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 132864
Reconstitution Centrifuge prior to opening. Reconstitute with sterilized PBS to a final concentration of 1mg/ml. Vortex followed by Centrifuge again to pellet the solution.
Target Species Human, Mouse, Rat, Guinea Pig
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.