Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NBP156919

CPEB3 Antibody, Novus Biologicals™
SDP

Catalog No. NBP156919 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP156919 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP156919 Supplier Novus Biologicals Supplier No. NBP156919
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

CPEB3 Polyclonal specifically detects CPEB3 in Human samples. It is validated for Western Blot.

Specifications

Antigen CPEB3
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q8NE35
Gene Alias CPE-binding protein 3, cytoplasmic polyadenylation element binding protein 3, cytoplasmic polyadenylation element-binding protein 3, hCPEB-3, KIAA0940CPE-BP3
Gene Symbols CPEB3
Host Species Rabbit
Immunogen Synthetic peptides corresponding to CPEB3(cytoplasmic polyadenylation element binding protein 3) The peptide sequence was selected from the middle region of CPEB3 (NP_055727). Peptide sequence RTDNGNNLLPFQDRSRPYDTFNLHSLENSLMDMIRTDHEPLKGKHYPPSG.
Molecular Weight of Antigen 76 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 22849
Test Specificity Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Chicken: 92%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by.
Target Species Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.