CPEB3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156919

Catalog No. NBP156919

Description

CPEB3 Polyclonal specifically detects CPEB3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CPEB3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: CPE-binding protein 3, cytoplasmic polyadenylation element binding protein 3, cytoplasmic polyadenylation element-binding protein 3, hCPEB-3, KIAA0940CPE-BP3
• Host Species: Rabbit
• Molecular Weight of Antigen: 76 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Chicken: 92%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8NE35
• Gene Symbols: CPEB3
• Immunogen: Synthetic peptides corresponding to CPEB3(cytoplasmic polyadenylation element binding protein 3) The peptide sequence was selected from the middle region of CPEB3 (NP_055727). Peptide sequence RTDNGNNLLPFQDRSRPYDTFNLHSLENSLMDMIRTDHEPLKGKHYPPSG.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 22849
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only