Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CPNE5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP179677
Description
CPNE5 Polyclonal specifically detects CPNE5 in Mouse samples. It is validated for Western Blot.Specifications
| CPNE5 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| copine VKIAA1599CPN5COPN5, copine-5, DKFZp666C234 | |
| Rabbit | |
| 65 kDa | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Zebrafish: 77%. | |
| Human, Mouse, Rat, Pig, Bovine, Canine, Rabbit, Zebrafish | |
| IgG |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| NP_694806 | |
| CPNE5 | |
| Synthetic peptide directed towards the N terminal of human Cpne5The immunogen for this antibody is Cpne5. Peptide sequence SLSEFDSLAGSIPATKVEITVSCRNLLDKDMFSKSDPLCVMYTQGMENKQ. | |
| Affinity purified | |
| RUO | |
| 57699 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction