Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CPNE5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$499.50
Specifications
Antigen | CPNE5 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
CPNE5 Polyclonal specifically detects CPNE5 in Mouse samples. It is validated for Western Blot.Specifications
CPNE5 | |
Polyclonal | |
Rabbit | |
NP_694806 | |
57699 | |
Synthetic peptide directed towards the N terminal of human Cpne5The immunogen for this antibody is Cpne5. Peptide sequence SLSEFDSLAGSIPATKVEITVSCRNLLDKDMFSKSDPLCVMYTQGMENKQ. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
copine VKIAA1599CPN5COPN5, copine-5, DKFZp666C234 | |
CPNE5 | |
IgG | |
65 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title