Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CPS1 Antibody, Novus Biologicals™

CPS1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15477520 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15477520 20 μL
NBP154775 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15477520 Supplier Novus Biologicals Supplier No. NBP15477520UL

Description

Rabbit Polyclonal Antibody

CPS1 Polyclonal specifically detects CPS1 in Human, Porcine samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen CPS1
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. P31327
Gene Alias carbamoyl-phosphate synthase [ammonia], mitochondrial, carbamoyl-phosphate synthase 1, mitochondrial, carbamoyl-phosphate synthetase 1, mitochondrial, carbamoylphosphate synthetase I, Carbamoyl-phosphate synthetase I, CPSase I, CPSASE1, EC 6.3.4.16
Gene Symbols CPS1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to CPS1(carbamoyl-phosphate synthetase 1, mitochondrial) The peptide sequence was selected from the middle region of CPS1. Peptide sequence YPSVTNYLYVTYNGQEHDVNFDDHGMMVLGCGPYHIGSSVEFDWCAVSSI.
Molecular Weight of Antigen 165 kDa
Purification Method Protein A purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1373
Target Species Human, Pig
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.