CPSF1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157434

Catalog No. NBP157434

Description

CPSF1 Polyclonal specifically detects CPSF1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CPSF1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: cleavage and polyadenylation specific factor 1, 160kD subunit, cleavage and polyadenylation specific factor 1, 160kDa, Cleavage and polyadenylation specificity factor 160 kDa subunit, cleavage and polyadenylation specificity factor subunit 1, CPSF 160 kDa subunit, CPSF160, HSU37012, P/cl.18, polyadenylation specificity factor
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 29894
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q10570
• Gene Symbols: CPSF1
• Immunogen: Synthetic peptides corresponding to CPSF1(cleavage and polyadenylation specific factor 1, 160kDa) The peptide sequence was selected from the middle region of CPSF1. Peptide sequence GCYDMWTVIAPVRKEEEDNPKGEGTEQEPSTTPEADDDGRRHGFLILSRE.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: This product is specific to Subunit or Isoform: 1.
• Target Species: Human, Rat, Equine
• Isotype: IgG