Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CPSF1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP157434 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP157434 100 μL
NBP15743420 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP157434 Supplier Novus Biologicals Supplier No. NBP157434
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

CPSF1 Polyclonal specifically detects CPSF1 in Human samples. It is validated for Western Blot.

Specifications

Antigen CPSF1
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q10570
Gene Alias cleavage and polyadenylation specific factor 1, 160kD subunit, cleavage and polyadenylation specific factor 1, 160kDa, Cleavage and polyadenylation specificity factor 160 kDa subunit, cleavage and polyadenylation specificity factor subunit 1, CPSF 160 kDa subunit, CPSF160, HSU37012, P/cl.18, polyadenylation specificity factor
Gene Symbols CPSF1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to CPSF1(cleavage and polyadenylation specific factor 1, 160kDa) The peptide sequence was selected from the middle region of CPSF1. Peptide sequence GCYDMWTVIAPVRKEEEDNPKGEGTEQEPSTTPEADDDGRRHGFLILSRE.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 29894
Test Specificity This product is specific to Subunit or Isoform: 1.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Rat, Equine
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.