Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CRACC/SLAMF7 Antibody, Novus Biologicals™
SDP

Catalog No. NBP255899 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP255899 100 μL
NB394764 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP255899 Supplier Novus Biologicals Supplier No. NBP255899
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

CRACC/SLAMF7 Polyclonal specifically detects CRACC/SLAMF7 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

Antigen CRACC/SLAMF7
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 1-4 ug/ml
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias 19A, CD2 subset 1, CD2-like receptor activating cytotoxic cells, CD319, CD319 antigen, CRACCCD2-like receptor-activating cytotoxic cells, CS119A24 protein, Membrane protein FOAP-12, Novel Ly9, novel LY9 (lymphocyte antigen 9) like protein, Protein 19A, SLAM family member 7
Gene Symbols SLAMF7
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SGPVKELVGSVGGAVTFPLKSKVKQVDSIVWTFNTTPLVTIQPEGGTIIVTQNRNRERVDFPDGGYSLKLSKLKKNDSGIYYVGIYSSSL
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Immunology
Primary or Secondary Primary
Gene ID (Entrez) 57823
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.