Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Novus Biologicals™ CREG Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Supplier: Novus Biologicals™ NBP258172PEP
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human CREG. Source: E.coli Amino Acid Sequence: YATLTMTLAQTNFCKKHGFDPQSPLCVHIMLSGTVTKVNETEMDIAKHSLFIRHPEMKTWPSSHNWFFAKLNITNIWLLD The CREG Recombinant Protein Antigen is derived from E. coli. The CREG Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.Specifications
8804 | |
CREG Recombinant Protein Antigen | |
PBS and 1M Urea, pH 7.4. | |
cellular repressor of E1A-stimulated genes, cellular repressor of E1A-stimulated genes 1CREG, protein CREG1 | |
Unlabeled | |
100μL | |
Cancer, Cell Cycle and Replication | |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52090. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
>80% by SDS-PAGE and Coomassie blue staining | |
Store at −20C. Avoid freeze-thaw cycles. | |
Blocking/Neutralizing, Control | |
CREG1 | |
Recombinant Protein Antigen | |
RUO | |
E.Coli |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?
Provide Content Correction