CRHR2/CRF2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP213875

Catalog No. NBP213875

Description

CRHR2/CRF2 Polyclonal specifically detects CRHR2/CRF2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CRHR2/CRF2
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: corticotropin releasing hormone receptor 2, corticotropin-releasing factor receptor 2, Corticotropin-releasing hormone receptor 2, CRF2, CRF2R, CRFR2, CRF-R2, CRF-R-2, CRFR-2, CRH2R, CRH-R2, CRH-R-2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: CRHR2
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: PCPEYFNGVKYNTTRNAYRECLENGTWASKINYSQCEPILDDKQRKYDLHYR
• Quantity: 0.1 mL
• Research Discipline: GPCR, Neuroscience, Neurotransmission
• Gene ID (Entrez): 1395
• Target Species: Human
• Isotype: IgG

For Research Use Only