CRISPLD2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP324765

Catalog No. NB301687

Description

CRISPLD2 Polyclonal antibody specifically detects CRISPLD2 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

• Antigen: CRISPLD2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
• Gene Alias: CRISP11, CRISP-11, Cysteine-rich secretory protein 11, cysteine-rich secretory protein LCCL domain containing 2, cysteine-rich secretory protein LCCL domain-containing 2, DKFZP434B044, LCCL domain containing cysteine-rich secretory protein 2, LCCL domain-containing cysteine-rich secretory protein 2, LCRISP2, MGC74865
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein CRISPLD2 using the following amino acid sequence: YLLPNVTLLEELLSKYQHNESHSRVRRAIPREDKEEILMLHNKLRGQVQPQASN
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunocytochemistry
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 83716
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG