CRN Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP310706100UL

Catalog No. NB126313

Description

CRN Polyclonal specifically detects CRN in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CRN
• Classification: Polyclonal
• Dilution: Western Blot 1.0 ug/ml
• Gene Alias: CLF, Clf1, Crn, Crooked Neck-Like 1, Crn, Crooked Neck-Like 1 (Drosophila), CRNKL1, Crooked Neck (Drosophila Crn Homolog)-Like 1, Crooked Neck Homolog, Crooked Neck Pre-MRNA Splicing Factor 1, Crooked Neck Pre-MRNA Splicing Factor-Like 1 (Drosophila), Crooked Neck-Like 1, Crooked Neck-Like Protein 1, hCrn, MSTP021, SYF3, SYF3 Pre-MRNA-Splicing Factor
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human CRN (NP_057736). Peptide sequence SFEEEFGTASDKERVDKLMPEKVKKRRKVQTDDGSDAGWEEYFDYIFPED
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS buffer, 2% sucrose
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51340
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.