Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CRN Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$499.50
Specifications
| Antigen | CRN |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
CRN Polyclonal specifically detects CRN in Human samples. It is validated for Western Blot.Specifications
| CRN | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| CLF, Clf1, Crn, Crooked Neck-Like 1, Crn, Crooked Neck-Like 1 (Drosophila), CRNKL1, Crooked Neck (Drosophila Crn Homolog)-Like 1, Crooked Neck Homolog, Crooked Neck Pre-MRNA Splicing Factor 1, Crooked Neck Pre-MRNA Splicing Factor-Like 1 (Drosophila), Crooked Neck-Like 1, Crooked Neck-Like Protein 1, hCrn, MSTP021, SYF3, SYF3 Pre-MRNA-Splicing Factor | |
| The immunogen is a synthetic peptide directed towards the C-terminal region of Human CRN (NP_057736). Peptide sequence SFEEEFGTASDKERVDKLMPEKVKKRRKVQTDDGSDAGWEEYFDYIFPED | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 51340 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title