CRTAC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP157722

Catalog No. NBP157722

Description

CRTAC1 Polyclonal specifically detects CRTAC1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CRTAC1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: ASPIC, ASPIC1CEP-68acidic secreted protein in cartilage, cartilage acidic protein 1, CEP68, chondrocyte expressed protein 68 kDa CEP-68,68 kDa chondrocyte-expressed protein, FLJ10320
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55118
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9NQ79
• Gene Symbols: CRTAC1
• Immunogen: Synthetic peptides corresponding to CRTAC1 (cartilage acidic protein 1) The peptide sequence was selected from the N terminal of CRTAC1)(50ug). Peptide sequence FTAVTNSVLPPDYDSNPTQLNYGVAVTDVDHDGDFEIVVAGYNGPNLVLK.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Chicken: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 76%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Isotype: IgG