Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CRTAC1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	CRTAC1
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP157722 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP157722	100 μL	Each of 1 for $487.50	Only null left	Sign In or Register to check your price. Add to Cart

Description

CRTAC1 Polyclonal specifically detects CRTAC1 in Human samples. It is validated for Western Blot.

Specifications

Antigen	CRTAC1
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	Q9NQ79
Gene ID (Entrez)	55118
Immunogen	Synthetic peptides corresponding to CRTAC1 (cartilage acidic protein 1) The peptide sequence was selected from the N terminal of CRTAC1)(50ug). Peptide sequence FTAVTNSVLPPDYDSNPTQLNYGVAVTDVDHDGDFEIVVAGYNGPNLVLK.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	ASPIC, ASPIC1CEP-68acidic secreted protein in cartilage, cartilage acidic protein 1, CEP68, chondrocyte expressed protein 68 kDa CEP-68,68 kDa chondrocyte-expressed protein, FLJ10320
Gene Symbols	CRTAC1
Isotype	IgG

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

CRTAC1 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents