CSGLCAT Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18808625UL

Catalog No. NB418318

Description

CSGLCAT Polyclonal specifically detects CSGLCAT in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CSGLCAT
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: Chondroitin glucuronyltransferase, chondroitin polymerizing factor 2KIAA1402chPF-2, Chondroitin synthase 3, chondroitin synthase-3, ChPF-2, CHSY3, ChSy-3chondroitin sulfate glucuronyltransferase, CSGlcA-T, CSGLCAT, EC 2.4.1.226, N-acetylgalactosaminyl-proteoglycan 3-beta-glucuronosyltransferase
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 54480
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: CHPF2
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:PCVEAVGERGGPQNPDSRARLDQSDEDFKPRIVPYYRDPNKPYKKVLRTRYIQTELGSRERLLVAVLTSRATLST
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only