Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CSHL1 Antibody, Novus Biologicals™

CSHL1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP159312 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP159312 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP159312 Supplier Novus Biologicals Supplier No. NBP159312
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

CSHL1 Polyclonal specifically detects CSHL1 in Human samples. It is validated for Western Blot.

Specifications

Antigen CSHL1
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q14406
Gene Alias chorionic somatomammotropin hormone-like 1, Chorionic somatomammotropin-like, CS-5, CSHP1, CSLchorionic somatomammotropin CS-5, growth hormone cluster, hCS-L, Lactogen-like, MGC149868
Gene Symbols CSHL1
Host Species Rabbit
Immunogen Synthetic peptides corresponding to CSHL1(chorionic somatomammotropin hormone-like 1) The peptide sequence was selected from the C terminal of CSHL1. Peptide sequence GQTLKQTYSKFDTNSHNHDALLKNYGLLHCFRKDMDKVETFLRMVQCRSV.
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 1444
Test Specificity Expected identity based on immunogen sequence: Guinea pig: 100%; Hippopotamus: 100%; White-cheeked gibbon: 100%; Red deer: 100%; Rabbit: 100%; Cat: 100%; Golden hamster: 100%; Alpaca: 100%; Canine: 100%; Giraffe: 100%; Chimpanzee: 100%; Pygmy slow loris: 100%; Northern lesser bushbaby: 100%; Lesser Malay chevrotain: 100%; Thick-tailed galago: 100%; Crowned lemur: 100%; Red ruffed lemur: 100%; Greater dwarf lemur: 100%; Saddleback dolphin: 100%; Common turkey: 100%; African elephant: 100%; Equine: 100%; Zebu: 100%; Bovine: 100%; Dromedary: 100%; Wild yak: 100%; Domestic gayal: 100%; Sheep: 100%; Goat: 100%; Arctic fox: 100%; Pig: 100%; Mouse: 100%; American mink: 100%; Red fox: 100%; Ehrenberg's mole rat: 100%; Jungle crow: 100%; Warthog: 100%; Indian elephant: 100%; Domestic water buffalo: 100%; Rat: 100%;.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Equine, Guinea Pig, Goat, Rabbit, Sheep
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.