csl/RBPJK Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP256071

Catalog No. NBP256071

Description

csl/RBPJK Polyclonal specifically detects csl/RBPJK in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: csl/RBPJK
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1-4 ug/ml
• Gene Alias: CBF-1, csl, H-2K binding factor-2, IGKJRB1RBPSUHCBF1, IGKJRBRBP-J kappa, immunoglobulin kappa J region recombination signal binding protein 1, J kappa-recombination signal-binding protein, KBF2, RBP-JK, RBPJKMGC61669, RBP-Jrecombining binding protein suppressor of hairless (Drosophila), recombination signal binding protein for immunoglobulin kappa J region, recombining binding protein suppressor of hairless, Renal carcinoma antigen NY-REN-30, SUH, suppressor of hairless homolog
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 3516
• Target Species: Human
• Isotype: IgG

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: RBPJ
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SAFREGWRWVRQPVQVPVTLVRNDGIIYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGSYTNASTNSTSVTSSTATVVS
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only