Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
csl/RBPJK Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | csl/RBPJK |
---|---|
Applications | Immunocytochemistry, Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
csl/RBPJK Polyclonal specifically detects csl/RBPJK in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
csl/RBPJK | |
Polyclonal | |
Rabbit | |
Human | |
CBF-1, csl, H-2K binding factor-2, IGKJRB1RBPSUHCBF1, IGKJRBRBP-J kappa, immunoglobulin kappa J region recombination signal binding protein 1, J kappa-recombination signal-binding protein, KBF2, RBP-JK, RBPJKMGC61669, RBP-Jrecombining binding protein suppressor of hairless (Drosophila), recombination signal binding protein for immunoglobulin kappa J region, recombining binding protein suppressor of hairless, Renal carcinoma antigen NY-REN-30, SUH, suppressor of hairless homolog | |
RBPJ | |
IgG | |
Affinity Purified |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
RUO | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
3516 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SAFREGWRWVRQPVQVPVTLVRNDGIIYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGSYTNASTNSTSVTSSTATVVS | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title