CSNK1A1L Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179514

Catalog No. NBP179514

Description

CSNK1A1L Polyclonal specifically detects CSNK1A1L in Human samples. It is validated for Western Blot.

Specifications

• Antigen: CSNK1A1L
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: casein kinase 1, alpha 1-like, casein kinase I alpha S-like, casein kinase I isoform alpha-like, CK1, CKI-alpha-like, EC 2.7.11, EC 2.7.11.1, MGC33182
• Host Species: Rabbit
• Molecular Weight of Antigen: 39 kDa
• Quantity: 100 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 122011
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_660204
• Gene Symbols: CSNK1A1L
• Immunogen: Synthetic peptide directed towards the middle region of human CSNK1A1LThe immunogen for this antibody is CSNK1A1L. Peptide sequence TLNHQYDYTFDWTMLKQKAAQQAASSSGQGQQAQTQTGKQTEKNKNNVKD.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: This product recognizes Human. Zebrafish: 79%; Dog: 77%; Pig: 77%; Rat: 77%; Horse: 77%; Mouse: 77%; Guinea pig: 77%.
• Target Species: Human, Mouse, Rat, Canine, Equine, Guinea Pig, Zebrafish
• Isotype: IgG