Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CSRP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP180293
Description
CSRP2 Polyclonal specifically detects CSRP2 in Human samples. It is validated for Western Blot.Specifications
CSRP2 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
CRP2LIM domain only protein 5, cysteine and glycine-rich protein 2, Cysteine-rich protein 2, LMO5LMO-5, SMLIM, SmLIMLIM domain only 5, smooth muscle, Smooth muscle cell LIM protein | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Expected identity based on immunogen sequence: Xenopus: 100%; Bovine: 100%; Chicken: 100%; Canine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rat: 100%; Zebrafish: 85%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
NP_001312 | |
CSRP2 | |
Synthetic peptide directed towards the C terminal of human CSRP2. Peptide sequence FRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ. | |
100 μL | |
Core ESC Like Genes, DNA Repair, DNA replication Transcription Translation and Splicing, Stem Cell Markers | |
1466 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction