Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CSRP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | CSRP2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
CSRP2 Polyclonal specifically detects CSRP2 in Human samples. It is validated for Western Blot.Specifications
CSRP2 | |
Polyclonal | |
Rabbit | |
Core ESC Like Genes, DNA Repair, DNA replication Transcription Translation and Splicing, Stem Cell Markers | |
CRP2LIM domain only protein 5, cysteine and glycine-rich protein 2, Cysteine-rich protein 2, LMO5LMO-5, SMLIM, SmLIMLIM domain only 5, smooth muscle, Smooth muscle cell LIM protein | |
CSRP2 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
NP_001312 | |
1466 | |
Synthetic peptide directed towards the C terminal of human CSRP2. Peptide sequence FRCAKCGKSLESTTLTEKEGEIYCKGCYAKNFGPKGFGYGQGAGALVHAQ. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title