Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CSRP3 Antibody, Novus Biologicals™

CSRP3 Antibody, Novus Biologicals™
SDP

Catalog No. NB438219 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
0.1 mL
25ul
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB438219 25ul
NBP213880 0.1 mL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NB438219 Supplier Novus Biologicals Supplier No. NBP21388025UL
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

CSRP3 Polyclonal specifically detects CSRP3 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen CSRP3
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias Cardiac LIM protein, CLPMGC14488, CMD1Mcardiac LIM domain protein, CMH12, CRP3cysteine and glycine-rich protein 3, cysteine and glycine-rich protein 3 (cardiac LIM protein), Cysteine-rich protein 3, LIM domain only 4, LIM domain protein, cardiac, LMO4, MLPMGC61993, Muscle LIM protein
Gene Symbols CSRP3
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to the amino acids: GAGCLSTDTGEHLGLQFQQSPKPARSVTTSNPSKFTAKFGESEKCPRCGKSVYA
Purification Method Affinity Purified
Quantity 25ul
Regulatory Status RUO
Research Discipline DNA Repair, DNA replication Transcription Translation and Splicing
Primary or Secondary Primary
Gene ID (Entrez) 8048
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.