Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CT45A1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP24670425UL
Description
CT45A1 Polyclonal antibody specifically detects CT45A1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
CT45A1 | |
Polyclonal | |
Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Q8N7B7 | |
Rabbit | |
Immunogen affinity purified | |
RUO | |
541466 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. | |
IgG |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2), 40% Glycerol | |
Cancer/testis antigen 45-1, Cancer/testis antigen 45A1, cancer/testis antigen CT45-1, cancer/testis antigen family 45 member A1, cancer/testis antigen family 45, member A1, CT45, CT45.1, CT45-1XX-FW88277B6.1 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: QGPTAVRKRFFESIIKEAARCMRRDFVKHLKKKLKRMI | |
25 μL | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction