Learn More
Description
Specifications
Specifications
| Antigen | CT45A1 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | Cancer/testis antigen 45-1, Cancer/testis antigen 45A1, cancer/testis antigen CT45-1, cancer/testis antigen family 45 member A1, cancer/testis antigen family 45, member A1, CT45, CT45.1, CT45-1XX-FW88277B6.1 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of Human CT45A1 (NP_001017417). Peptide sequence VFKRPRECDSPSYQKRQRMALLARKQGAGDSLIAGSAMSKAKKLMTGHAI |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
