CT83 Antibody (CL4762), Novus Biologicals™

Mouse Monoclonal Antibody

Supplier:  Novus Biologicals NBP25906225UL

Catalog No. NB393143

Description

CT83 Monoclonal specifically detects CT83 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CXorf61
• Classification: Monoclonal
• Dilution: Western Blot 1:500 - 1:1000, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: chromosome X open reading frame 61, CT83, CT83Cancer/testis antigen 83, FLJ20611, FLJ22913, kita-kyushu lung cancer antigen 1, KKLC1, KK-LC-1, KK-LC-1KKLC1, RP3-452H17.2
• Host Species: Mouse
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 203413
• Target Species: Human
• Form: Purified

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2), containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: CXORF61
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.
• Isotype: IgG1

For Research Use Only