Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CT83 Antibody (CL4762), Novus Biologicals™

Mouse Monoclonal Antibody
$382.00 - $648.50
Specifications
Antigen | CXorf61 |
---|---|
Dilution | Western Blot 1:500 - 1:1000, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
Classification | Monoclonal |
Conjugate | Unconjugated |
Form | Purified |
Description
CT83 Monoclonal specifically detects CT83 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
CXorf61 | |
Monoclonal | |
Purified | |
RUO | |
chromosome X open reading frame 61, CT83, CT83Cancer/testis antigen 83, FLJ20611, FLJ22913, kita-kyushu lung cancer antigen 1, KKLC1, KK-LC-1, KK-LC-1KKLC1, RP3-452H17.2 | |
CXORF61 | |
IgG1 | |
Protein A purified |
Western Blot 1:500 - 1:1000, Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
Unconjugated | |
Mouse | |
Human | |
203413 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title