CT83 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP184343

Catalog No. NBP184343

Description

CT83 Polyclonal specifically detects CT83 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CXorf61
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: chromosome X open reading frame 61, CT83, CT83Cancer/testis antigen 83, FLJ20611, FLJ22913, kita-kyushu lung cancer antigen 1, KKLC1, KK-LC-1, KK-LC-1KKLC1, RP3-452H17.2
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 203413
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: CXORF61
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:QRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only