CTDSPL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23191325UL

Catalog No. NB437153

Description

CTDSPL Polyclonal specifically detects CTDSPL in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CTDSPL
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Accession No.: O15194
• Gene Symbols: CTDSPL
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: AIITQVTNPKEDEGRLPGAGEKASQCNVSLKKQRSRSILSSFFCCFRDYNVEAPPPSSPSVLPPLVEENGGLQKGDQ
• Quantity: 25 μL
• Research Discipline: Signal Transduction
• Gene ID (Entrez): 10217
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: C3orf8, Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 3, CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) smallphosphatase-like, CTD small phosphatase-like protein, CTDSP-like, EC 3.1.3, HYA22, NIF1, NIFL, NIF-like protein, NLI-interacting factor 1, Nuclear LIM interactor-interacting factor 1, Protein YA22, PSR1, RB protein serine phosphatase from chromosome 3, RBSP3EC 3.1.3.16, SCP3chromosome 3 open reading frame 8, Small CTD phosphatase 3, Small C-terminal domain phosphatase 3, YA22
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only