Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CTDSPL Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$382.00 - $610.00

Specifications

Antigen	CTDSPL
Dilution	Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Applications	Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB437153 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP23191325UL	25 μL	Each for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP231913 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP231913	0.1 mL	Each for $610.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

CTDSPL Polyclonal specifically detects CTDSPL in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen	CTDSPL
Applications	Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Target Species	Human
Gene Accession No.	O15194
Gene ID (Entrez)	10217
Immunogen	This antibody was developed against a recombinant protein corresponding to amino acids: AIITQVTNPKEDEGRLPGAGEKASQCNVSLKKQRSRSILSSFFCCFRDYNVEAPPPSSPSVLPPLVEENGGLQKGDQ
Primary or Secondary	Primary
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

Dilution	Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Classification	Polyclonal
Host Species	Rabbit
Research Discipline	Signal Transduction
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias	C3orf8, Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 3, CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) smallphosphatase-like, CTD small phosphatase-like protein, CTDSP-like, EC 3.1.3, HYA22, NIF1, NIFL, NIF-like protein, NLI-interacting factor 1, Nuclear LIM interactor-interacting factor 1, Protein YA22, PSR1, RB protein serine phosphatase from chromosome 3, RBSP3EC 3.1.3.16, SCP3chromosome 3 open reading frame 8, Small CTD phosphatase 3, Small C-terminal domain phosphatase 3, YA22
Gene Symbols	CTDSPL
Isotype	IgG
Purification Method	Affinity Purified
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

CTDSPL Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents