CTGF/CCN2 Antibody (CL5339), Novus Biologicals™

Mouse Monoclonal Antibody

Supplier:  Novus Biologicals NBP261415

Catalog No. NBP261415

Description

CTGF/CCN2 Monoclonal specifically detects CTGF/CCN2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CTGF/CCN2
• Classification: Monoclonal
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: CCN2
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LPSPDCPFPRRVKLPGKCCEEWVCDEPKDQTVVGPALAAYRLEDTFGPDPTMIRANCLVQTTEWSACSKTCGMG
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of human CTGF/CCN2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG1

• Applications: Western Blot, Immunohistochemistry (Paraffin)
• Clone: CL5339
• Dilution: Western Blot 1:500 - 1:1000, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: CCN2IGFBP-8, connective tissue growth factor, HCS24, Hypertrophic chondrocyte-specific protein 24, IBP-8, IGF-binding protein 8, IGFBP8CCN family member 2, Insulin-like growth factor-binding protein 8, MGC102839, NOV2
• Host Species: Mouse
• Purification Method: Protein A purified
• Research Discipline: Angiogenesis, Cancer, Cell Biology, Cytokine Research, Growth and Development, Immunology, Innate Immunity
• Gene ID (Entrez): 1490
• Target Species: Human, Mouse, Rat
• Form: Purified