Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CTIF Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP15742320UL
Description
CTIF Polyclonal specifically detects CTIF in Human samples. It is validated for Western Blot.Specifications
| CTIF | |
| Polyclonal | |
| Western Blot 1:100-1:2000 | |
| O43310 | |
| CTIF | |
| Synthetic peptides corresponding to KIAA0427(KIAA0427) The peptide sequence was selected from the N terminal of KIAA0427. Peptide sequence QVQGLLADKTEGDGESERTQSHISQWTADCSEPLDSSCSFSRGRAPPQQN. | |
| 20 μL | |
| Primary | |
| Human | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS & 2% Sucrose. with No Preservative | |
| CBP80/20-dependent translation initiation factor, KIAA0427Gm672 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 9811 | |
| Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction