CTP synthase Antibody, Novus Biologicals™

Catalog No.	Quantity
NBP152892	100 μL

Catalog No. NBP152892 Supplier Novus Biologicals Supplier No. NBP152892

Description

Rabbit Polyclonal Antibody

CTP synthase Polyclonal specifically detects CTP synthase in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CTP synthase
• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Classification: Polyclonal
• Concentration: 1 mg/ml
• Conjugate: Unconjugated
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Accession No.: P17812
• Gene Alias: CTP synthase, CTP synthase 1, CTP synthetase 1, cytidine 5-prime triphosphate synthetase, cytidine 5'-triphosphate synthetase, EC 6.3.4.2, UTP--ammonia ligase 1
• Gene Symbols: CTPS1
• Host Species: Rabbit
• Immunogen: Synthetic peptides corresponding to CTPS(CTP synthase) The peptide sequence was selected from the N terminal of CTPS. Peptide sequence SMPFIEAFRQFQFKVKRENFCNIHVSLVPQPSSTGEQKTKPTQNSVRELR.
• Molecular Weight of Antigen: 67 kDa
• Purification Method: Protein A purified
• Quantity: 100 μL
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Gene ID (Entrez): 1503
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Zebrafish
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Form: Purified
• Isotype: IgG

For Research Use Only