Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. CUGBP1/CELF1 Antibody, Novus Biologicals™

CUGBP1/CELF1 Antibody, Novus Biologicals™
SDP

Catalog No. NBP276536 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP276536 100 μL
NB402747 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP276536 Supplier Novus Biologicals Supplier No. NBP276536
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

CUGBP1/CELF1 Polyclonal specifically detects CUGBP1/CELF1 in Human samples. It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.

Specifications

Antigen CUGBP1/CELF1
Applications Western Blot, Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 μ/mL, Immunocytochemistry/Immunofluorescence 1 - 4 μ/mL
Formulation PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide
Gene Alias BRUNOL250 kDa nuclear polyadenylated RNA-binding protein, bruno-like 2, Bruno-like protein 2, CUG RNA-binding protein, CUG triplet repeat, RNA binding protein 1, CUG triplet repeat, RNA-binding protein 1, CUG-BP, CUG-BP- and ETR-3-like factor 1, CUGBP Elav-like family member 1, CUGBP, Elav-like family member 1, CUGBP1CUG triplet repeat RNA-binding protein 1, CUGBPCELF-1, Deadenylation factor CUG-BP, EDEN-BP, EDEN-BP homolog, embryo deadenylation element binding protein, Embryo deadenylation element-binding protein homolog, hNab50, NAB50CUG-BP1, NAPOR, nuclear polyadenylated RNA-binding protein, 50-kD, RNA-binding protein BRUNOL-2
Gene Symbols CELF1
Host Species Rabbit
Immunogen This antibody was developed against Recombinant Protein corresponding to amino acids: KRMAQQLQQQMQQISAASVWGNLAGLNTLGPQYLALYLQLLQQTASSGNLNTLSSLHPMGGLNAMQLQNLAA
Quantity 100 μL
Primary or Secondary Primary
Gene ID (Entrez) 10658
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.