Learn More
Description
Specifications
Specifications
| Antigen | CUGBP1/CELF1 |
| Applications | Western Blot, Immunocytochemistry, Immunofluorescence |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 0.4 μ/mL, Immunocytochemistry/Immunofluorescence 1 - 4 μ/mL |
| Formulation | PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide |
| Gene Alias | BRUNOL250 kDa nuclear polyadenylated RNA-binding protein, bruno-like 2, Bruno-like protein 2, CUG RNA-binding protein, CUG triplet repeat, RNA binding protein 1, CUG triplet repeat, RNA-binding protein 1, CUG-BP, CUG-BP- and ETR-3-like factor 1, CUGBP Elav-like family member 1, CUGBP, Elav-like family member 1, CUGBP1CUG triplet repeat RNA-binding protein 1, CUGBPCELF-1, Deadenylation factor CUG-BP, EDEN-BP, EDEN-BP homolog, embryo deadenylation element binding protein, Embryo deadenylation element-binding protein homolog, hNab50, NAB50CUG-BP1, NAPOR, nuclear polyadenylated RNA-binding protein, 50-kD, RNA-binding protein BRUNOL-2 |
| Gene Symbols | CELF1 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KRMAQQLQQQMQQISAASVWGNLAGLNTLGPQYLALYLQLLQQTASSGNLNTLSSLHPMGGLNAMQLQNLAA |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
