Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

CutA Antibody, Novus Biologicals™
SDP

Catalog No. NB301683 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB301683 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB301683 Supplier Novus Biologicals Supplier No. NBP324769
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

CutA Polyclonal antibody specifically detects CutA in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen CutA
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias Acetylcholinesterase-associated proteinBrain acetylcholinesterase putative membrane anchor, ACHAP, C6orf82, chromosome 6 open reading frame 82, cutA divalent cation tolerance homolog (E. coli), divalent cation tolerant protein CUTA, MGC111154, protein CutA
Host Species Rabbit
Immunogen This antibody has been engineered to specifically recognize the recombinant protein CutA using the following amino acid sequence: LLPRVLLTMASGSPPTQPSPASDSGSGYVPGSVSAAFVTCPNEKVAKEIARAVVEKRLAACVNLIPQI
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Cell Biology
Primary or Secondary Primary
Gene ID (Entrez) 51596
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.