Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CutA Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP159527
Description
CutA Polyclonal specifically detects CutA in Human samples. It is validated for Western Blot.Specifications
CutA | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
Acetylcholinesterase-associated proteinBrain acetylcholinesterase putative membrane anchor, ACHAP, C6orf82, chromosome 6 open reading frame 82, cutA divalent cation tolerance homolog (E. coli), divalent cation tolerant protein CUTA, MGC111154, protein CutA | |
Rabbit | |
Affinity purified | |
RUO | |
51596 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
O60888 | |
CUTA | |
Synthetic peptides corresponding to CUTA(cutA divalent cation tolerance homolog (E. coli)) The peptide sequence was selected from the middle region of CUTA. Peptide sequence AFVTCPNEKVAKEIARAVVEKRLAACVNLIPQITSIYEWKGKIEEDSEVL. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%. | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction