CX3CR1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP23855425UL

Catalog No. NB396768

Description

CX3CR1 Polyclonal specifically detects CX3CR1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CX3CR1
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Accession No.: P49238
• Gene Symbols: CX3CR1
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LEAFKLADLDFRKSSLASGWRMASGAFTMDQFPESVTENFEYDDLAEACYIGDIVVFGTVF
• Quantity: 25 μL
• Research Discipline: GPCR
• Gene ID (Entrez): 1524
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: Beta chemokine receptor-like 1, CCRL1, chemokine (C-C) receptor-like 1, chemokine (C-X3-C motif) receptor 1, chemokine (C-X3-C) receptor 1, CMKBRL1, CMK-BRL1, CMK-BRL-1, CMKDR1, CX3C chemokine receptor 1, Fractalkine receptor, G protein-coupled receptor 13, GPR13G-protein coupled receptor 13, GPRV28, V28C-X3-C CKR-1
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles.