Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
CXCL8/IL-8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications
Supplier: Novus Biologicals NBP23381925UL
Description
CXCL8/IL-8 Polyclonal specifically detects CXCL8/IL-8 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
CXCL8/IL-8 | |
Polyclonal | |
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200 | |
P10145 | |
IL8 | |
This antibody was developed against a recombinant protein corresponding to amino acids: SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKF | |
25 μL | |
Angiogenesis, Cancer, Chemokines and Cytokines, Cytokine Research, Immunology, Innate Immunity, Signal Transduction | |
3576 | |
Human, Mouse | |
IgG |
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
3-10C, AMCF-I, C-X-C motif chemokine 8, CXCL8SCYB8, Emoctakin, GCP-1TSG-1, interleukin 8, K60, LECT, MDNCFb-ENAP, member 8, MONAPGCP1, NAP-1NAP1, Neutrophil-activating protein 1, Protein 3-10C, T cell chemotactic factor, T-cell chemotactic factor | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction