CXCL8/IL-8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Catalog Number	Mfr. No.	Quantity
NB436740	Novus Biologicals NBP23381925UL	25 μL
NBP233819	Novus Biologicals NBP233819	0.1 mL

Description

CXCL8/IL-8 Polyclonal specifically detects CXCL8/IL-8 in Human, Mouse samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: CXCL8/IL-8
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Target Species: Human, Mouse
• Gene Accession No.: P10145
• Gene ID (Entrez): 3576
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKF
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200
• Classification: Polyclonal
• Host Species: Rabbit
• Research Discipline: Angiogenesis, Cancer, Chemokines and Cytokines, Cytokine Research, Immunology, Innate Immunity, Signal Transduction
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: 3-10C, AMCF-I, C-X-C motif chemokine 8, CXCL8SCYB8, Emoctakin, GCP-1TSG-1, interleukin 8, K60, LECT, MDNCFb-ENAP, member 8, MONAPGCP1, NAP-1NAP1, Neutrophil-activating protein 1, Protein 3-10C, T cell chemotactic factor, T-cell chemotactic factor
• Gene Symbols: IL8
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

For Research Use Only