Learn More
CXCR5 Rabbit anti-Human, Mouse, Rat, Clone: 9Q10I2, Novus Biologicals™
Shop All R&D Systems Products

Description
Specifications
Specifications
| Antigen | CXCR5 |
| Applications | Western Blot, Immunofluorescence |
| Classification | Monoclonal |
| Clone | 9Q10I2 |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1:500 - 1:2000, Immunocytochemistry/Immunofluorescence 1:50 - 1:200 |
| Formulation | PBS, 0.05% BSA, 50% glycerol, pH7.3 |
| Gene Alias | BLR1MDR-15, Burkitt lymphoma receptor 1, Burkitt lymphoma receptor 1, GTP binding protein (chemokine (C-X-C motif)receptor 5), Burkitt lymphoma receptor 1, GTP-binding protein, CD185, CD185 antigen, chemokine (C-X-C motif) receptor 5, C-X-C chemokine receptor type 5, CXC-R5, MDR15CXCR-5, MGC117347, Monocyte-derived receptor 15 |
| Host Species | Rabbit |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 273-372 of human CXCR5 (P32302). SPYHIVIFLDTLARLKAVDNTCKLNGSLPVAITMCEFLGLAHCCLNPMLYTFAGVKFRSDLSRLLTKLGCTGPASLCQLFPSWRRSSLSESENATSLTTF |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.